PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00300.1.p
Common NameEUGRSUZ_B00300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 409aa    MW: 46510 Da    PI: 4.9698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.67.8e-15165211148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT++Ed ll ++v+q+G  +W+ ++++++ gR +kqc++rw+++l
  Eucgr.B00300.1.p 165 KGQWTAQEDWLLTQLVEQFGLSRWSYVSQMLP-GRLGKQCRERWHNHL 211
                       799*****************************.*************97 PP

2Myb_DNA-binding56.18.4e-18217259145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +  WT+eE++++++a+++ G++ W+ Ia++++ +Rt +++k++w+
  Eucgr.B00300.1.p 217 KETWTEEEEKIIIQAHTEIGNK-WSEIAKRLP-NRTQNSIKNHWN 259
                       578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.666160211IPR017930Myb domain
SMARTSM007174.2E-12164213IPR001005SANT/Myb domain
SuperFamilySSF466893.26E-29164258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-26166219IPR009057Homeodomain-like
CDDcd001672.30E-11168211No hitNo description
PfamPF139219.2E-16168225No hitNo description
PROSITE profilePS5129425.078212266IPR017930Myb domain
SMARTSM007171.8E-15216264IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-21220265IPR009057Homeodomain-like
CDDcd001673.84E-6227262No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MEFQTKLDED LASHQVSLSD TGKRNETTLA TTVTLKRSFL QDFHLVEQFF LSGSPSDLAY  60
EKQITCFDLP MFIYTCKQFT DGQGVVMDNF EVGGIDTASK YDTSHMFFDF QQNVDPVNFV  120
ASGEVSRTSD EYGYYKNNFT SMSKEVSSLS ARRTCEVCKR SQASKGQWTA QEDWLLTQLV  180
EQFGLSRWSY VSQMLPGRLG KQCRERWHNH LRPNIKKETW TEEEEKIIIQ AHTEIGNKWS  240
EIAKRLPNRT QNSIKNHWNA TKRRQFTKRK RRSKYPRASP LQEYIQSLNL SASKRFPLQS  300
SGGDRATAVN NDASRNKSAS SSDDRLVQNI IKFGELPEQL FDEKLLQEGC ALDSLLGDLP  360
CPPDATVEDG GGGGEELGME MLDMDSLLES EELNEDLDLV EMITQIYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-421652654104C-Myb DNA-Binding Domain
1mse_C2e-421652654104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261270KRRQFTKRKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045548.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-79MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A059CYD40.0A0A059CYD4_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-60myb domain protein 98